PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_B348717F1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 361aa    MW: 37197.5 Da    PI: 8.483
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_B348717F1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.91.9e-3788147261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            +e+ lkcprCds+ntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Traes_1AS_B348717F1.1  88 PEQGLKCPRCDSANTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 147
                            57899*************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3772146IPR003851Zinc finger, Dof-type
PfamPF027016.7E-3290146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67792146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MIFPPSFLDS SSWNDNQHAH HQQVAAASCG GGAGDGGCNN HELLQPSIMQ QGTLAEGGDG  60
GGSGGQVVGP AKPMSMSERA RLARVPLPEQ GLKCPRCDSA NTKFCYFNNY SLSQPRHFCR  120
ACRRYWTRGG ALRNVPVGGG YRRHAKRAKP KQAAAAAAAG APAASGAASG GSTTSSTTSA  180
CTTMSNPAPV LPAMLQNGGG GNLSGLLPPL LRLADFDAMS LGSTFSGMGK PSPVDSPAGY  240
YLGGGGGGAV PGLEQWRVQQ MQGFPFFQAM ADQQHTLTPA AAPAMAMPGM FHYLGLGNGG  300
DGRGVHEDDG GDQQFHHAMP SKRECYPRSG SIAMYGGDHH LTAGAGYTSS YSNAATGNHL  360
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843530.0AM084353.1 Hordeum vulgare subsp. vulgare dof5 gene for dof zinc finger protein 5, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638255.11e-104PREDICTED: dof zinc finger protein DOF3.6
TrEMBLW4ZXY70.0W4ZXY7_WHEAT; Uncharacterized protein
STRINGBGIOSGA018944-PA1e-103(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-40OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]